BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_H01 (768 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.2 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.0 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 8.2 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -2 Query: 677 REPENGHPDHQGNXGPPSETRRGNNHTRRFQHEK 576 ++ + DH+ N G + GNN ++ H K Sbjct: 447 KDKKGSQVDHKNNLGDSKNNQDGNNGEKKKPHIK 480 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -2 Query: 677 REPENGHPDHQGNXGPPSETRRGNNHTRRFQHEK 576 ++ + DH+ N G + GNN ++ H K Sbjct: 339 KDKKGSQVDHKNNLGDSKNNQDGNNGEKKKPHIK 372 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 248 GAPPSPWQVSLPSCPPAHTKL 310 G P WQ + P PPA ++L Sbjct: 60 GLLPLAWQANSPPSPPAPSEL 80 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.4 bits (43), Expect = 8.2 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -3 Query: 679 GESRRMDTQTIKEMXDHQVRLVEEIIIHEDFNTKSLKNDVAL 554 G R D K H + L + ++H FN K+ +A+ Sbjct: 608 GIGRSPDQNVKKINLKHALDLDRQGLLHRQFNLPPAKDTIAV 649 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,656 Number of Sequences: 336 Number of extensions: 4111 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -