BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_G12 (844 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.66 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 8.1 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.66 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = -1 Query: 730 KQPPXXXKQVQARASVVPQPTXRGKFPXPRR-TPPGAVPS*PP 605 +QP Q PQ RG P P + PPG P PP Sbjct: 14 QQPSSGAPGPQPSPHQSPQAPQRGSPPNPSQGPPPGGPPGAPP 56 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +1 Query: 382 SDVQPGGDASPRDAPVCTPQSVLFTGRYVRALRGETRVS 498 SDVQPG + P + S +G VR G R S Sbjct: 269 SDVQPGHGSPPVKQHRSSSASTTCSGHTVRCFTGGPRKS 307 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 35 VLI*HTDSFLHIHRT 79 V++ HT S LH+H T Sbjct: 662 VIVQHTQSQLHLHLT 676 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,156 Number of Sequences: 438 Number of extensions: 2966 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27067071 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -