BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F12 (825 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 1.5 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 24 2.0 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 4.5 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 4.5 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 4.5 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 4.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 4.5 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 24.2 bits (50), Expect = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 197 NNAHNNQLIHRTQPQNRERPN 259 NN HN+Q H ++ NR N Sbjct: 443 NNQHNDQAHHSSKSNNRHNNN 463 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.8 bits (49), Expect = 2.0 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 567 VRFWYWHFNGDRIGLLYFDLVGLVN-GDLNFVGHWLAYGHWVGLSTWTG 710 ++F W FNGD++ L ++ V+ D G W L+T+ G Sbjct: 167 MKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIINVPAYLNTYKG 215 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 457 VKEVPYPVKYHVPIYF 410 ++++P PV VP+Y+ Sbjct: 108 IEQIPVPVPVPVPVYY 123 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 457 VKEVPYPVKYHVPIYF 410 ++++P PV VP+Y+ Sbjct: 108 IEQIPVPVPVPVPVYY 123 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 457 VKEVPYPVKYHVPIYF 410 ++++P PV VP+Y+ Sbjct: 108 IEQIPVPVPIPVPVYY 123 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 457 VKEVPYPVKYHVPIYF 410 ++++P PV VP+Y+ Sbjct: 108 IEQIPVPVPVPVPVYY 123 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.6 bits (46), Expect = 4.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 457 VKEVPYPVKYHVPIYF 410 ++++P PV VP+Y+ Sbjct: 341 IEQIPVPVPVPVPVYY 356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,732 Number of Sequences: 438 Number of extensions: 3322 Number of successful extensions: 21 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26338809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -