BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F11 (841 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 27 0.94 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 3.8 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 26.6 bits (56), Expect = 0.94 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -1 Query: 148 IKMLSYLSHVTVDNYKS--ESQTLYCQESVNKHGLYIP 41 I L ++HVT Y + + +T+YC+ N+ YIP Sbjct: 722 IDWLQKINHVTSRQYPTINDIETVYCKLMYNRERSYIP 759 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 24.6 bits (51), Expect = 3.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 458 LLSPKIKHMCNKLIKYWGVIAR*HSCSIKP 547 LLS IK + +I WG+I+ C KP Sbjct: 531 LLSKVIKPRLDCIIGKWGIISTAQKCCNKP 560 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 777,501 Number of Sequences: 2352 Number of extensions: 15738 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88891965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -