BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F09 (811 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 6.4 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 8.4 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 6.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 666 LDGCRVPDKRRRHLQTLG 719 ++G R+P +R RH QTLG Sbjct: 58 VNGNRLPIQRIRHRQTLG 75 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.4 bits (48), Expect = 8.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -2 Query: 252 ETFNAISHYDPSFV*RVSKCKVMVKNHFNI*YYYIKSLF 136 E I +Y P R+ ++MV N N+ Y I +LF Sbjct: 388 EALGIIEYYHPRKQLRIQLARIMVLNMLNL-YSLIFALF 425 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,630 Number of Sequences: 2352 Number of extensions: 12027 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -