BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_F04 (789 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding pr... 29 0.16 AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 24 4.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 6.2 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 23 8.1 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 8.1 >AY146748-1|AAO12063.1| 279|Anopheles gambiae odorant-binding protein AgamOBP41 protein. Length = 279 Score = 29.1 bits (62), Expect = 0.16 Identities = 20/76 (26%), Positives = 34/76 (44%) Frame = +3 Query: 60 WLLEPVDIYNVNAPPTLRYKF*GLKYSYNGCLTLQAQTHYCFTAEIGRVVVPTRADSQEV 239 ++ +P D YNVN T + L+ + C L ++ C+ G + R DS V Sbjct: 98 FVTDPADAYNVNRTETCLQELPALELNAEKCCGLAFESFLCYYYNYGNL----RQDS--V 151 Query: 240 LPPVKYILLYISTAPC 287 P+ ++ L T+ C Sbjct: 152 FVPLDHLQLQHVTSRC 167 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 Query: 506 LDCWPWVVRRRRWALS*CWDS 568 + CW +V RW L CW S Sbjct: 372 MQCWIDLVEAWRWQLYMCWVS 392 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 6.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 174 HYCFTAEIGRVVVPTRADSQEVLP-PVKYILLY 269 H F AEIG +V DS E+LP P + Y Sbjct: 939 HIEFHAEIGMSLVLKVGDSSEMLPAPANFPTCY 971 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 23.4 bits (48), Expect = 8.1 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -1 Query: 561 QHQDRAHRRRLTTHGQQSRRHCYRGEERLWNKV 463 Q Q++ H+R+ QQ ++ + ++ LW V Sbjct: 281 QQQNQQHQRQQQQQQQQRQQQQQQEQQELWTTV 313 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.4 bits (48), Expect = 8.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -2 Query: 767 YRXQRKQTRPVKKSSKSETNXSDTCLR 687 +R Q+KQT+ KK T + C R Sbjct: 182 FRVQKKQTKQNKKIQIKHTKTKNGCCR 208 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,360 Number of Sequences: 2352 Number of extensions: 16330 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -