BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_E16 (816 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 25 1.1 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 5.9 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 5.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.8 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 24.6 bits (51), Expect = 1.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 295 RLKWTDTIETNNNKINISNALWF 363 R K +T T + +N+S+A+WF Sbjct: 594 RFKLANTDGTEEDALNLSSAVWF 616 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 489 GHKFSISSESRLMNLYSPQVAKKLLFIIFFTHS 391 GH+ +I+S + LY P V + II H+ Sbjct: 256 GHESNIASVLHALQLYYPHVPEYSSSIIMELHN 288 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 5.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 489 GHKFSISSESRLMNLYSPQVAKKLLFIIFFTHS 391 GH+ +I+S + LY P V + II H+ Sbjct: 271 GHESNIASVLHALQLYYPHVPEYSSSIIMELHN 303 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 117 NCFAATECCCFD 82 +CFA CC FD Sbjct: 742 HCFALCHCCDFD 753 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.8 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 Query: 693 QXDGQXRPNQPQQLKPRPPKE 631 Q Q + QPQQ +P+P ++ Sbjct: 1514 QQQPQQQSQQPQQQQPQPQQQ 1534 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,137 Number of Sequences: 438 Number of extensions: 3606 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -