BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D23 (840 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021492-12|CAJ76949.1| 622|Caenorhabditis elegans Hypothetical... 34 0.11 AL021492-11|CAA16378.1| 684|Caenorhabditis elegans Hypothetical... 34 0.11 >AL021492-12|CAJ76949.1| 622|Caenorhabditis elegans Hypothetical protein Y45F10D.3b protein. Length = 622 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 450 APPEPPMRGGGRAAEPDVYYERGHERF-YEDEAHYREEPR 334 A P PP G A +P Y RGHE+ +EDEA Y +E R Sbjct: 55 ANPNPPAALGDEALDPFEKY-RGHEKIKWEDEAAYEKEKR 93 >AL021492-11|CAA16378.1| 684|Caenorhabditis elegans Hypothetical protein Y45F10D.3a protein. Length = 684 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 450 APPEPPMRGGGRAAEPDVYYERGHERF-YEDEAHYREEPR 334 A P PP G A +P Y RGHE+ +EDEA Y +E R Sbjct: 117 ANPNPPAALGDEALDPFEKY-RGHEKIKWEDEAAYEKEKR 155 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,294,937 Number of Sequences: 27780 Number of extensions: 164933 Number of successful extensions: 447 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2077023564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -