BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D21 (794 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY241928-1|AAO85277.1| 806|Caenorhabditis elegans xylosyltransf... 29 5.1 AJ496235-1|CAD42732.1| 806|Caenorhabditis elegans peptide O-xyl... 29 5.1 AC025722-4|AAK68509.3| 806|Caenorhabditis elegans Squashed vulv... 29 5.1 AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical ... 28 6.7 >AY241928-1|AAO85277.1| 806|Caenorhabditis elegans xylosyltransferase protein. Length = 806 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -1 Query: 491 VRGSYADLMIVTTRYWRYL*TSWDVVD*LLLSKVELTCWNFMTGDKCASDK 339 +R +Y +++ ++ L + + D LL+S + LT W G +CAS K Sbjct: 420 LRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLK 470 >AJ496235-1|CAD42732.1| 806|Caenorhabditis elegans peptide O-xylosyltransferase protein. Length = 806 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -1 Query: 491 VRGSYADLMIVTTRYWRYL*TSWDVVD*LLLSKVELTCWNFMTGDKCASDK 339 +R +Y +++ ++ L + + D LL+S + LT W G +CAS K Sbjct: 420 LRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLK 470 >AC025722-4|AAK68509.3| 806|Caenorhabditis elegans Squashed vulva protein 6 protein. Length = 806 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -1 Query: 491 VRGSYADLMIVTTRYWRYL*TSWDVVD*LLLSKVELTCWNFMTGDKCASDK 339 +R +Y +++ ++ L + + D LL+S + LT W G +CAS K Sbjct: 420 LRKTYESILLPLESFYHTLAFNSEFCDDLLMSNLRLTNWYRKQGCRCASLK 470 >AF067613-4|AAU20845.1| 327|Caenorhabditis elegans Hypothetical protein F56D6.7 protein. Length = 327 Score = 28.3 bits (60), Expect = 6.7 Identities = 25/60 (41%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +3 Query: 525 RVSDRGTPTN*IIAFPPSLPFYNIVYKINS-DDD*YLFFTI*NPFEFPVHLNLIHMLLLV 701 RV D GT II F PFY V+KIN D L F I N F V L +I +++V Sbjct: 26 RVIDYGT----IIIFFAIFPFYVYVHKINDVKDREALVFPITNHFYKTVVLMIIGYVIVV 81 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,953,617 Number of Sequences: 27780 Number of extensions: 343841 Number of successful extensions: 687 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -