BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D18 (859 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 22 7.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 7.1 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 647 PPTHGNICQKSSKYHFVNEYLYRP 576 P HG +C + +H Y YRP Sbjct: 474 PSMHGGVCDPYTPWH--TFYDYRP 495 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = -3 Query: 707 KXXWICPDGFTFHQVHLXCMPPTHGNICQKSSKYHFV 597 K WI +GF V M G +C KY + Sbjct: 412 KMKWIKDNGFAGAMVWTIDMDDFSGTVCGGQVKYPLI 448 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,427 Number of Sequences: 336 Number of extensions: 2367 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23763101 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -