BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D18 (859 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_14644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/35 (34%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +1 Query: 565 SWFTGR--YRYSFTKWYFDDFWQMLPCVGGMXIRC 663 +W T R Y Y W + FW +LP +G C Sbjct: 139 TWMTTRKVYIYCLIAWIYSAFWALLPIIGISSYEC 173 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 28.3 bits (60), Expect = 8.5 Identities = 17/60 (28%), Positives = 29/60 (48%) Frame = -3 Query: 716 DSVKXXWICPDGFTFHQVHLXCMPPTHGNICQKSSKYHFVNEYLYRPVNQDEVDKKPNVS 537 +S K I P FH H +PP+ N+ + S K+H ++ +R D + PN++ Sbjct: 16 NSTKNGQIPPLSVKFH--HPGQIPPSWWNLTENSVKFHLISVKFHR---DDSPNPNPNLN 70 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,619,364 Number of Sequences: 59808 Number of extensions: 262775 Number of successful extensions: 655 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2443309836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -