BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D15 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41306| Best HMM Match : Ribosomal_L19e (HMM E-Value=8.5) 31 0.81 SB_40156| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 >SB_41306| Best HMM Match : Ribosomal_L19e (HMM E-Value=8.5) Length = 220 Score = 31.5 bits (68), Expect = 0.81 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 8/60 (13%) Frame = +2 Query: 431 KFPTLSASCSARACIRVGS---ERCKIAHS-----LGSSNDAKSSSLMIILDTRECTR*R 586 K+P L+ + C R G +C +AHS LGSSN +SS +I REC + R Sbjct: 39 KYPDLNENLIREICRRSGEIPWRKCVVAHSSRSRVLGSSNTKQSSEQVIGRGHRECRQPR 98 >SB_40156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 422 ESTKFPTLSASCSARACIRVGSERCKIAHSLGSSNDAKSS 541 +S P ++ C RAC+ V S A SLG ND+ SS Sbjct: 2 DSYFIPWVAVECFKRACLGVRSGAPHFADSLGRPNDSPSS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,378,804 Number of Sequences: 59808 Number of extensions: 323671 Number of successful extensions: 809 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 809 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -