BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D12 (854 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0306 + 20058640-20059159,20060406-20060819,20060921-200611... 56 3e-08 03_01_0034 + 318432-318825,318902-319851 56 3e-08 01_06_1060 + 34162161-34162554,34162613-34162675,34163262-341635... 56 3e-08 01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349 56 3e-08 06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379 55 6e-08 03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998 55 6e-08 02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467 55 6e-08 03_05_0575 + 25747813-25748206,25748567-25748614,25750296-257505... 55 8e-08 07_03_0994 + 23190344-23190456,23191367-23191581,23191663-231918... 34 0.17 03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557,624... 34 0.17 11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535,788... 33 0.22 03_05_0974 + 29324025-29324117,29325064-29325298,29325385-293257... 33 0.22 02_05_1127 + 34292894-34293284,34293948-34295443 29 3.6 03_02_0943 + 12598616-12598789,12599790-12601250 29 6.2 >05_04_0306 + 20058640-20059159,20060406-20060819,20060921-20061190, 20062179-20062849 Length = 624 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLVSEYQQY Sbjct: 580 GEGMDEMEFTEAESNMNDLVSEYQQY 605 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 551 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 579 >03_01_0034 + 318432-318825,318902-319851 Length = 447 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLVSEYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVSEYQQY 425 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 371 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 399 >01_06_1060 + 34162161-34162554,34162613-34162675,34163262-34163531, 34163944-34164623 Length = 468 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLVSEYQQY Sbjct: 421 GEGMDEMEFTEAESNMNDLVSEYQQY 446 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 392 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 420 >01_02_0004 - 10097759-10098438,10098973-10099242,10099956-10100349 Length = 447 Score = 56.4 bits (130), Expect = 3e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLVSEYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVSEYQQY 425 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 371 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 399 >06_03_1086 - 27494238-27494914,27495471-27495740,27495986-27496379 Length = 446 Score = 55.2 bits (127), Expect = 6e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLV+EYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVAEYQQY 425 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 371 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 399 >03_06_0176 + 32158462-32158855,32159960-32160229,32160328-32160998 Length = 444 Score = 55.2 bits (127), Expect = 6e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLV+EYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVAEYQQY 425 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 371 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 399 >02_01_0499 + 3619909-3620302,3621123-3621392,3621788-3622467 Length = 447 Score = 55.2 bits (127), Expect = 6e-08 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 661 GXGMDEMEFTEAESNMNDLVSEYQQY 584 G GMDEMEFTEAESNMNDLV+EYQQY Sbjct: 400 GEGMDEMEFTEAESNMNDLVAEYQQY 425 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 371 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 399 >03_05_0575 + 25747813-25748206,25748567-25748614,25750296-25750565, 25750658-25751334 Length = 462 Score = 54.8 bits (126), Expect = 8e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWYT 663 S +IQE+F+R S QFTAMFRRKAFLHWYT Sbjct: 387 STSIQEMFRRVSEQFTAMFRRKAFLHWYT 415 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = -2 Query: 655 GMDEMEFTEAESNMNDLVSEYQQY 584 GMDEMEFTEAESNMNDLV+EYQQY Sbjct: 418 GMDEMEFTEAESNMNDLVAEYQQY 441 >07_03_0994 + 23190344-23190456,23191367-23191581,23191663-23191862, 23192420-23192928,23193048-23193363 Length = 450 Score = 33.9 bits (74), Expect = 0.17 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 743 AIQELFKRXSXQFTAMFRRKAFLHWY 666 A+ E+F R +F M+ ++AF+HWY Sbjct: 383 AVAEVFSRIDHKFDLMYAKRAFVHWY 408 >03_02_0186 - 6243487-6243799,6243892-6244400,6244495-6244557, 6245482-6245681,6246125-6246519,6246776-6246888 Length = 530 Score = 33.9 bits (74), Expect = 0.17 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 743 AIQELFKRXSXQFTAMFRRKAFLHWY 666 A+ E+F R +F M+ ++AF+HWY Sbjct: 464 AVAEVFSRIDRKFDLMYAKRAFVHWY 489 >11_02_0058 + 7879859-7879951,7880844-7881078,7881165-7881535, 7881648-7882304 Length = 451 Score = 33.5 bits (73), Expect = 0.22 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWY 666 S ++ E+F R +F M+ ++AF+HWY Sbjct: 381 STSVVEVFSRIDIKFDLMYSKRAFVHWY 408 >03_05_0974 + 29324025-29324117,29325064-29325298,29325385-29325755, 29325864-29326520 Length = 451 Score = 33.5 bits (73), Expect = 0.22 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 749 SXAIQELFKRXSXQFTAMFRRKAFLHWY 666 S ++ E+F R +F M+ ++AF+HWY Sbjct: 381 STSVVEVFSRIDHKFDLMYSKRAFVHWY 408 >02_05_1127 + 34292894-34293284,34293948-34295443 Length = 628 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 547 RQTLRPRRRWPPGTVGTRRQG 609 R T +P+RRWPPG+ G +G Sbjct: 83 RATGQPKRRWPPGSSGGGARG 103 >03_02_0943 + 12598616-12598789,12599790-12601250 Length = 544 Score = 28.7 bits (61), Expect = 6.2 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = -3 Query: 336 ICSIHSLIFHQASLRARSEICKG*SKIDTFYLHMCSRNKMADQNS 202 + I +L+ ++S S +C G + Y +CS+ + AD+NS Sbjct: 309 LAEIKALLSSESSSECGSSVCDGVTLSAEEYFTLCSKAQEADENS 353 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,485,136 Number of Sequences: 37544 Number of extensions: 313487 Number of successful extensions: 700 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 699 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -