BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D11 (813 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharom... 27 3.2 SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pomb... 26 5.5 >SPAC1296.03c |sxa2||serine carboxypeptidase Sxa2|Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.1 bits (57), Expect = 3.2 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 273 FYFAISTVIRKTEASRLTRVASIFNCITNIAPYNLRN 383 + F+ ST +RK EA + ++FN I+ Y+L N Sbjct: 299 YNFSTSTSLRKREALDGEDIGNVFNSISGCDLYSLSN 335 >SPBC3B9.16c |nup120||nucleoporin Nup120|Schizosaccharomyces pombe|chr 2|||Manual Length = 1136 Score = 26.2 bits (55), Expect = 5.5 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 38 TLLTSLNHYQLNS*FSTYDKLITSLL 115 +L+TS Y+L S F+ DKL SLL Sbjct: 700 SLITSQQDYELQSKFAGCDKLFLSLL 725 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,754,404 Number of Sequences: 5004 Number of extensions: 49050 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -