BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D10 (843 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 3.0 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 3.0 EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 22 5.3 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 22 5.3 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 412 NASENVLIVCARWKEGHTGYMAVYN 338 NA+E+ L + R+ EGH + VY+ Sbjct: 36 NATEHKLPISMRFNEGHQLSIIVYS 60 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 412 NASENVLIVCARWKEGHTGYMAVYN 338 NA+E+ L + R+ EGH + VY+ Sbjct: 36 NATEHKLPISMRFNEGHQLSIIVYS 60 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Frame = -3 Query: 535 LLNIKQLS-ADENDTSLLDLVNLRSDASL 452 L N++Q + AD+ND ++ DLV L + +L Sbjct: 632 LKNLRQKAEADKNDKAVKDLVILLFETAL 660 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/49 (24%), Positives = 22/49 (44%) Frame = -3 Query: 343 YNPSRQDLHANLTAVPSVPGTITIQNVSPAVKLVTNYTKNYQPAEDVLV 197 YNPS++ ++T T+T ++ Y + QP + +LV Sbjct: 157 YNPSQKRQFLHITLASGRTLTVTPSHLLVLDDRTMKYAQKLQPGDFLLV 205 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,181 Number of Sequences: 336 Number of extensions: 3198 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23244256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -