BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D09 (795 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 23 2.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.7 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 10.0 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 10.0 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 21 10.0 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.4 bits (48), Expect = 2.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 764 VHAEGRWLPAGP 729 +H E R+LPAGP Sbjct: 6 IHWEARYLPAGP 17 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 3.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 208 VLVPAKSTVVVSYVPIKHEKREKD 137 +L+ ST VVS KH +R +D Sbjct: 13 LLLSIASTYVVSVAGYKHSRRHRD 36 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -3 Query: 697 RPPSAAPVPVTEDADALASRINKTLGSWPILQLTDTN 587 R P+A+P P + A GS +LQ +N Sbjct: 739 RSPNASPSPAEQCASTTTITARSPQGSQGLLQCATSN 775 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 10.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 519 FQLTKTTPLF*IW 481 F L K +PLF IW Sbjct: 303 FNLVKISPLFTIW 315 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 700 LRPPSAAPVPVTEDADALASRIN 632 +RPPS +PV D + + IN Sbjct: 1 IRPPSKQGLPVLVDFNIFVADIN 23 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 21.4 bits (43), Expect = 10.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 519 FQLTKTTPLF*IW 481 F L K +PLF IW Sbjct: 53 FNLVKISPLFTIW 65 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,011 Number of Sequences: 438 Number of extensions: 4094 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -