BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D04 (835 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.3 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 6.9 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.1 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 235 GAPPSPWQVSLPSCPPAHTKL 297 G P WQ + P PPA ++L Sbjct: 60 GLLPLAWQANSPPSPPAPSEL 80 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 186 DQPGQLVAAVTYGTGQGGSTVALASVPALLSPGAH 290 D G + Y T T +LA+ LLS G H Sbjct: 200 DMSGGMHQMANYSTDYSSLTHSLAASNHLLSSGQH 234 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 9.1 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 165 PAPDAPGDQPGQLVAAVTYGTGQGGS-TVALASVPALLSPG 284 P P G LV+ +Y G G V++AS L G Sbjct: 78 PVPHTSSFNMGYLVSPYSYANGAAGPIPVSMASKMGLAPTG 118 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,385 Number of Sequences: 336 Number of extensions: 3715 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -