BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_D02 (828 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z34531-1|CAA84292.1| 454|Homo sapiens coproporphyrinogen oxidas... 56 2e-07 Z28409-1|CAA82250.1| 354|Homo sapiens coproporphyrinogen oxidas... 56 2e-07 D16611-1|BAA04033.1| 354|Homo sapiens coproporphyrinogen oxidas... 56 2e-07 BC023554-1|AAH23554.1| 454|Homo sapiens coproporphyrinogen oxid... 56 2e-07 BC023551-1|AAH23551.1| 454|Homo sapiens coproporphyrinogen oxid... 56 2e-07 BC017210-1|AAH17210.1| 454|Homo sapiens coproporphyrinogen oxid... 56 2e-07 AK223481-1|BAD97201.1| 454|Homo sapiens coproporphyrinogen oxid... 56 2e-07 >Z34531-1|CAA84292.1| 454|Homo sapiens coproporphyrinogen oxidase protein. Length = 454 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 401 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 437 >Z28409-1|CAA82250.1| 354|Homo sapiens coproporphyrinogen oxidase protein. Length = 354 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 301 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 337 >D16611-1|BAA04033.1| 354|Homo sapiens coproporphyrinogen oxidase protein. Length = 354 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 301 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 337 >BC023554-1|AAH23554.1| 454|Homo sapiens coproporphyrinogen oxidase protein. Length = 454 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 401 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 437 >BC023551-1|AAH23551.1| 454|Homo sapiens coproporphyrinogen oxidase protein. Length = 454 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 401 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 437 >BC017210-1|AAH17210.1| 454|Homo sapiens coproporphyrinogen oxidase protein. Length = 454 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 401 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 437 >AK223481-1|BAD97201.1| 454|Homo sapiens coproporphyrinogen oxidase variant protein. Length = 454 Score = 55.6 bits (128), Expect = 2e-07 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -1 Query: 600 RGTKFGXHTXEARYESILMSLPLNAKWEYMHQVQPNS 490 RGTKFG T +R ESILMSLPL A+WEYMH NS Sbjct: 401 RGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENS 437 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,737,544 Number of Sequences: 237096 Number of extensions: 1650041 Number of successful extensions: 6104 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 6067 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6104 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -