Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= FWDP01_T7_C23
         (824 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    23   2.2  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   6.8  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 23.4 bits (48), Expect = 2.2
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -3

Query: 525 VLLSVISLLNEPNTFSPANVDASVMYRRWRDSKGKDKEYENIIRKQAQ 382
           +LL   +LL+   T     V AS +YR  +   G D+E E +I + AQ
Sbjct: 653 ILLFETALLSSGFTLDEPQVHASRIYRMIKLGLGIDEE-EAMITEDAQ 699


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 646  PDFS*KPNGWW 678
            PD++ KP+ WW
Sbjct: 1033 PDWTTKPSTWW 1043


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,831
Number of Sequences: 336
Number of extensions: 2685
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22621642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)