BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C22 (711 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 1.9 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 1.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 1.9 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 9.9 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 115 PHPRLQRSPCRLLRNPSRGQPGP 183 PHP L P L +P+ PGP Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGP 254 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 115 PHPRLQRSPCRLLRNPSRGQPGP 183 PHP L P L +P+ PGP Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGP 146 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = +1 Query: 115 PHPRLQRSPCRLLRNPSRGQPGPHGASENSPSSIPSPTY 231 P+P +QR L P P + +P S P PTY Sbjct: 267 PYP-MQRPKSASLSPPPHVYNPPDHIQQATPYSAPGPTY 304 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 169 GQPGPHGASENSPSSIPSPT 228 G PHG++ +S + PSP+ Sbjct: 252 GNITPHGSNTSSLITTPSPS 271 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,126 Number of Sequences: 336 Number of extensions: 2339 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -