BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C17 (814 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizos... 31 0.26 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 29 1.0 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 26 5.5 >SPBC11B10.05c |rsp1||random septum position protein Rsp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 30.7 bits (66), Expect = 0.26 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = -2 Query: 621 PSMSRSQFRTPSRYQCPPLTPSRSTSRTQ*KRPCRSQLTSPSTGHTQSTSRST 463 PS FR P+ PP SRS S + + RSQL S STS ST Sbjct: 301 PSKPEIPFRHPTSKPLPPKPLSRSKSSSLSRNQTRSQLNDLS-AENDSTSNST 352 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 28.7 bits (61), Expect = 1.0 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 593 PRQGTSARPLPRREAHPVPSRKGRAVPS*HPRRQAIPSP 477 P G P+P +A PVP+ A PS R ++PSP Sbjct: 1222 PSAGLPPVPVPTAKAPPVPAPSSEA-PSVSTPRSSVPSP 1259 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 26.2 bits (55), Expect = 5.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 527 LFYWVRDVLLDGVRGGHWYLDGVRNWLLDMDGHWAVNVYFN 649 L Y++ D+ RG H+ D + L MD A+N YFN Sbjct: 1546 LIYFILDIFQ--FRGLHFAYDEIDTDQLSMDLQDALNAYFN 1584 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,390,649 Number of Sequences: 5004 Number of extensions: 37554 Number of successful extensions: 114 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -