BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C12 (833 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 5e-25 SB_13648| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 9e-10 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 111 bits (268), Expect = 5e-25 Identities = 53/69 (76%), Positives = 63/69 (91%) Frame = -1 Query: 725 YTEFSLASLLXYALKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELI 546 Y EF+LAS+L + +KE +CSE S+RMTAMD A+KNAGEMIDKLTLT+NRTRQAVITREL+ Sbjct: 260 YQEFNLASMLFFGMKEQSCSEHSARMTAMDAATKNAGEMIDKLTLTYNRTRQAVITRELV 319 Query: 545 EIISGAAAL 519 EIISGAAA+ Sbjct: 320 EIISGAAAV 328 >SB_13648| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 61.3 bits (142), Expect = 9e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 614 EMIDKLTLTFNRTRQAVITRELIEIISGAAAL 519 EMIDKLTLT+NRTRQAVITREL+EIISGAAA+ Sbjct: 2 EMIDKLTLTYNRTRQAVITRELVEIISGAAAV 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,698,401 Number of Sequences: 59808 Number of extensions: 332571 Number of successful extensions: 702 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -