BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C12 (833 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-4|AAK68562.1| 299|Caenorhabditis elegans Hypothetical ... 117 9e-27 AC084158-3|AAL00872.1| 313|Caenorhabditis elegans Hypothetical ... 33 0.19 >AC084158-4|AAK68562.1| 299|Caenorhabditis elegans Hypothetical protein Y69A2AR.18a protein. Length = 299 Score = 117 bits (282), Expect = 9e-27 Identities = 58/71 (81%), Positives = 63/71 (88%) Frame = -1 Query: 731 QSYTEFSLASLLXYALKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRE 552 QSY+E+SLA L+ Y +KE A SEQSSRMTAMD ASKNAGEMIDKLTL FNRTRQAVITRE Sbjct: 229 QSYSEYSLAQLIYYGMKESATSEQSSRMTAMDGASKNAGEMIDKLTLAFNRTRQAVITRE 288 Query: 551 LIEIISGAAAL 519 LIEIISGAA + Sbjct: 289 LIEIISGAACV 299 >AC084158-3|AAL00872.1| 313|Caenorhabditis elegans Hypothetical protein Y69A2AR.18b protein. Length = 313 Score = 33.5 bits (73), Expect = 0.19 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -1 Query: 731 QSYTEFSLASLLXYALKEGACSE 663 QSY+E+SLA L+ Y +KE A SE Sbjct: 229 QSYSEYSLAQLIYYGMKESATSE 251 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,907,644 Number of Sequences: 27780 Number of extensions: 251198 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2072006206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -