BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C10 (818 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC130440-1|AAI30441.1| 1031|Homo sapiens M-phase phosphoprotein ... 30 8.8 AK023016-1|BAB14359.1| 692|Homo sapiens protein ( Homo sapiens ... 30 8.8 >BC130440-1|AAI30441.1| 1031|Homo sapiens M-phase phosphoprotein 9 protein. Length = 1031 Score = 30.3 bits (65), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 570 SSRKSLTPSKRKCLMKSKCLLTSPTRSTKE 481 S+RKS TP+KR+ ++ + SP RS KE Sbjct: 810 SNRKSSTPTKREIMLTPVTVAYSPKRSPKE 839 >AK023016-1|BAB14359.1| 692|Homo sapiens protein ( Homo sapiens cDNA FLJ12954 fis, clone NT2RP2005491, weakly similar to PARAMYOSIN. ). Length = 692 Score = 30.3 bits (65), Expect = 8.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -3 Query: 570 SSRKSLTPSKRKCLMKSKCLLTSPTRSTKE 481 S+RKS TP+KR+ ++ + SP RS KE Sbjct: 606 SNRKSSTPTKREIMLTPVTVAYSPKRSPKE 635 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,357,185 Number of Sequences: 237096 Number of extensions: 1552269 Number of successful extensions: 2391 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2391 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10203625794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -