BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C10 (818 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78539-3|CAB01730.1| 177|Caenorhabditis elegans Hypothetical pr... 31 1.3 AL033536-1|CAA22138.1| 908|Caenorhabditis elegans Hypothetical ... 28 9.2 >Z78539-3|CAB01730.1| 177|Caenorhabditis elegans Hypothetical protein C31E10.4 protein. Length = 177 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = -3 Query: 600 LKCQYXNPTKSSRKSLTPSKRKCLM----KSKCLLTSPTRSTKE 481 ++C+ PT SR+ LT S R+C+ + C + S TR K+ Sbjct: 1 MRCKIGTPTSISRRHLTDSARRCIQLVVGVACCSVPSATRKIKQ 44 >AL033536-1|CAA22138.1| 908|Caenorhabditis elegans Hypothetical protein Y53C10A.4 protein. Length = 908 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -2 Query: 490 YQGSSSAARQRSTLPGQ-VPRPYLLQE 413 Y+ SSS++ S++P PRPY L+E Sbjct: 703 YKSSSSSSSSTSSIPSDPAPRPYFLKE 729 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,252,986 Number of Sequences: 27780 Number of extensions: 228069 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2019417216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -