BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C08 (802 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 200 2e-53 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 1.9 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 7.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 7.6 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 200 bits (487), Expect = 2e-53 Identities = 93/96 (96%), Positives = 95/96 (98%) Frame = -1 Query: 634 QPSFXGMEACGIHETTYSSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 455 QPSF GMEACGIHETTY+SIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP Sbjct: 38 QPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAP 97 Query: 454 STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS 347 STMKIKIIAPPE+KYSVWIGGSILASLSTFQQMWIS Sbjct: 98 STMKIKIIAPPEKKYSVWIGGSILASLSTFQQMWIS 133 Score = 31.9 bits (69), Expect = 0.007 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -2 Query: 714 EXSXEXPDGQVITIGNXKIPLP 649 E S E PDGQVITIGN + P Sbjct: 12 EKSYELPDGQVITIGNERFRCP 33 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 1.9 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -1 Query: 559 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWI 398 DI++ Y + V MYP + M+K I+ + KI I P E K +WI Sbjct: 349 DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--IWI 398 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 530 RIVRWYHHVPWNRRPYAK 477 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 7.6 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 530 RIVRWYHHVPWNRRPYAK 477 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,930 Number of Sequences: 438 Number of extensions: 4139 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -