BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C06 (841 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.24 AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esteras... 22 5.3 AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esteras... 22 5.3 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 7.0 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.6 bits (56), Expect = 0.24 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 404 TSCESARVGATALPIFAVKQ*CVSVGRVGQPLNYTETLELISQGGWRV 547 +S +A++GA P+ G G L Y E +EL +GGW+V Sbjct: 270 SSASNAKLGA---PVKGAGNSGKYTGEAGM-LGYNEIVELQKEGGWKV 313 >AJ850291-1|CAH64511.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 139 PSITESDCLVNVSHLYINT*SKNFVSLFTKI 47 P+ TE + L+NV+ + NF+ + TK+ Sbjct: 477 PNPTEENPLINVTWKPVTRNEMNFLDIGTKL 507 >AJ850289-1|CAH64509.1| 533|Tribolium castaneum putative esterase protein. Length = 533 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 139 PSITESDCLVNVSHLYINT*SKNFVSLFTKI 47 P+ TE + L+NV+ + NF+ + TK+ Sbjct: 477 PNPTEENPLINVTWKPVTRNEMNFLDIGTKL 507 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 202 KMQTNNFVYIIQQFPFPNSRFKNAF 276 K +T F+ + QQ PFP F F Sbjct: 350 KPETLPFLNLQQQLPFPGYPFFGGF 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,435 Number of Sequences: 336 Number of extensions: 3726 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23140487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -