BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C06 (841 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) 30 2.7 SB_41284| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 28 8.2 >SB_36148| Best HMM Match : Laminin_EGF (HMM E-Value=4.7) Length = 540 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +1 Query: 262 FKNAFKCKCFXGH--SSLALRTVDHTTLILMLRSVRCFPF 375 F AF C+C H S+ + H + L+ S RCFP+ Sbjct: 471 FPIAFSCRCVSHHVLMSMCFPSRAHVDVFLIACSCRCFPY 510 >SB_41284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -2 Query: 705 RQEPAXPLHDAARSTRQHVTLPPMTLLSIIWVDELTAHLVLSGYRSP 565 R P + DAA S QHV+ +L + +W D L V YR P Sbjct: 15 RYWPPVYIADAACSVTQHVSFRYPSLANQLWGDSLGCFQVPDHYREP 61 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 28.3 bits (60), Expect = 8.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 502 VQRLPHPSNRNALLLHGKNGQ 440 VQR P P+ RN++ LHG Q Sbjct: 30 VQRRPEPTPRNSIFLHGLRAQ 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,875,507 Number of Sequences: 59808 Number of extensions: 475257 Number of successful extensions: 1078 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2371447782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -