BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C05 (814 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.1 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 23 8.5 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 25.4 bits (53), Expect = 2.1 Identities = 22/58 (37%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Frame = +1 Query: 49 KLLVSLLEPLH--DRRVEQVRLRQGRGVVTQLRAREGRQQTEWP---QLVRRLRSRHE 207 K+ VS+L L +R + RLR R + A EG QTE P + R LRS E Sbjct: 124 KMAVSILSALACVERELMTTRLRAERTEKSLKEALEGCSQTETPVNGKRGRNLRSTEE 181 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 23.4 bits (48), Expect = 8.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 707 TADDHEPVSASNPQQXRASE 648 + DDH+P+ N QQ R + Sbjct: 42 SVDDHQPLQQKNLQQQRREQ 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,132 Number of Sequences: 2352 Number of extensions: 10022 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -