BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C04 (847 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006603-4|AAF39747.2| 379|Caenorhabditis elegans Hypothetical ... 28 9.6 >AC006603-4|AAF39747.2| 379|Caenorhabditis elegans Hypothetical protein B0524.2 protein. Length = 379 Score = 27.9 bits (59), Expect = 9.6 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 359 SKRQFTSSNKKCDDNNIVDWISLSRAYLSKV 451 SK++ N++CDD+N+ D I ++ + S+V Sbjct: 4 SKKKSEEKNRQCDDSNVNDTILIAFSNYSEV 34 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,548,007 Number of Sequences: 27780 Number of extensions: 212926 Number of successful extensions: 410 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2098003600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -