BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_C02 (802 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 280 8e-76 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 280 8e-76 SB_56| Best HMM Match : Actin (HMM E-Value=0) 280 8e-76 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 280 1e-75 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 279 2e-75 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 278 3e-75 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 247 9e-66 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 96 3e-20 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 85 5e-17 SB_54| Best HMM Match : Actin (HMM E-Value=0) 83 3e-16 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 4e-12 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.007 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) 31 1.4 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.5 SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) 29 4.4 SB_19357| Best HMM Match : Metallothio_5 (HMM E-Value=3.4) 29 4.4 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 7.7 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 280 bits (687), Expect = 8e-76 Identities = 129/138 (93%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 201 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 260 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGGTTMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 261 VLSGGTTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 320 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGP+IVHRKCF Sbjct: 321 SKQEYDESGPAIVHRKCF 338 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 280 bits (687), Expect = 8e-76 Identities = 129/138 (93%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 239 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 298 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 299 VLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 358 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGPSIVHRKCF Sbjct: 359 SKQEYDESGPSIVHRKCF 376 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 280 bits (687), Expect = 8e-76 Identities = 129/138 (93%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 238 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 297 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGG+TMYPGIADRMQKEIT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 298 VLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 357 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGPSIVHRKCF Sbjct: 358 SKQEYDESGPSIVHRKCF 375 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 280 bits (686), Expect = 1e-75 Identities = 129/138 (93%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 239 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 298 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 299 VLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 358 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGPSIVHRKCF Sbjct: 359 SKQEYDESGPSIVHRKCF 376 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 279 bits (683), Expect = 2e-75 Identities = 128/138 (92%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 212 KSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANT 271 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 V+SGGTTMYPG+ADRMQKEI+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 272 VMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 331 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGP+IVHRKCF Sbjct: 332 SKQEYDESGPAIVHRKCF 349 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 278 bits (682), Expect = 3e-75 Identities = 128/138 (92%), Positives = 134/138 (97%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 +S LPDGQVITIGNERFRCPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANT Sbjct: 238 KSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANT 297 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 298 VLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 357 Query: 347 SKQEYDESGPSIVHRKCF 294 SKQEYDESGPSIVHRKCF Sbjct: 358 SKQEYDESGPSIVHRKCF 375 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 247 bits (604), Expect = 9e-66 Identities = 111/138 (80%), Positives = 125/138 (90%) Frame = -3 Query: 707 RSLRLPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANT 528 ++ LPDGQVI+IGNERFRCPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDLY+N Sbjct: 12 KTYELPDGQVISIGNERFRCPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNC 71 Query: 527 VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWI 348 VLSGG+TM+PGIADRMQKEI LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQQMWI Sbjct: 72 VLSGGSTMFPGIADRMQKEIAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWI 131 Query: 347 SKQEYDESGPSIVHRKCF 294 +K+EY E GP IVHRKCF Sbjct: 132 AKEEYHEYGPPIVHRKCF 149 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 96.3 bits (229), Expect = 3e-20 Identities = 57/154 (37%), Positives = 84/154 (54%), Gaps = 29/154 (18%) Frame = -3 Query: 695 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 516 LPDG+V+ + ERF PEALFQP + +E G+ E +N+I D+D R + Y + VLSG Sbjct: 246 LPDGRVVKLSGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSG 305 Query: 515 GTTMYPGIADRMQKEITAL---------------------APST-----MKIKI-IAPP- 420 G+TMYPG+ R+++EI L P T K KI I P Sbjct: 306 GSTMYPGLPSRLEREIKQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPP 365 Query: 419 ERKYSVWIGGSILAS-LSTFQQMWISKQEYDESG 321 RK+ V++GG++LA + W++++EY+E G Sbjct: 366 RRKHMVFMGGAVLADIMKDKDSFWMTRKEYEEKG 399 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 85.4 bits (202), Expect = 5e-17 Identities = 50/149 (33%), Positives = 75/149 (50%), Gaps = 17/149 (11%) Frame = -3 Query: 677 ITIGNERFRCPEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMY 501 + + ERF PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ Sbjct: 196 VDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMF 255 Query: 500 PGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLS 369 R+Q++I + P ++ ++I+ ++Y+VW GGS+LAS Sbjct: 256 RDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTP 315 Query: 368 TFQQMWISKQEYDESGPSIVHRKCF*THR 282 F + +K +YDE GPSI F HR Sbjct: 316 EFYSVCHTKADYDEHGPSICRHNPF-LHR 343 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 82.6 bits (195), Expect = 3e-16 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = -3 Query: 695 LPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 516 LPDGQ I IG+ERFR E LFQPS LG + GIHE+ + SI KCD+D+R +L+ N VLSG Sbjct: 2287 LPDGQSIRIGSERFRAAEPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 68.9 bits (161), Expect = 4e-12 Identities = 30/85 (35%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -3 Query: 617 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 438 G A G+ + S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 437 KII---APPERKYSVWIGGSILASL 372 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 52.4 bits (120), Expect = 4e-07 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = -3 Query: 581 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 426 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 425 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDE 327 PP + W+GG+I SL +++ Y + Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -3 Query: 578 SIMKCDVDIRKDLYANTVLSGGTTMYPG 495 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.62 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -3 Query: 647 PEALFQPSFLGMEACGIHET 588 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_49385| Best HMM Match : Actin (HMM E-Value=0.00022) Length = 921 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 695 LPDGQVITIGNERFRCPEALFQPSFL 618 LPDGQ+I+IG E E LF+P L Sbjct: 873 LPDGQMISIGYECISSMEPLFRPDLL 898 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 385 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 558 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 559 TS 564 S Sbjct: 815 AS 816 >SB_22949| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 158 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 679 SSPSETKDSVAQRLSSNPRSWVWK 608 S+ SETK SV +R + + W+W+ Sbjct: 96 STKSETKASVVERFNRTSKEWMWR 119 >SB_19357| Best HMM Match : Metallothio_5 (HMM E-Value=3.4) Length = 187 Score = 29.1 bits (62), Expect = 4.4 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -3 Query: 743 RRXPPXHPAXPXRS-LRLPDGQVITIGNERFRCPEALFQPSFLGMEACGI 597 +R PP A RS +RL DG+ + + CP F S G E CG+ Sbjct: 115 KRTPPSKQARHDRSGVRLSDGKDVCDCQD-LNCPGCHFPCSACGSEKCGV 163 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -1 Query: 412 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 293 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -1 Query: 370 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 260 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 7.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -3 Query: 533 NTVLSGGTTMYPGIADRMQKEITALAP 453 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 28.3 bits (60), Expect = 7.7 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 367 PSNKCGSRNKSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 248 P N+ G++ + +L P++TGS + RT + P+A C Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,417,023 Number of Sequences: 59808 Number of extensions: 502987 Number of successful extensions: 1466 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -