BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B24 (861 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 26 1.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 3.0 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 6.8 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 25.8 bits (54), Expect = 1.7 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = -2 Query: 680 DIRAMSRFGVIGR----QSQVASKCWSPQQSEAYFTPDXXF 570 DI+A RFGV+ R +VA K + Q+ +++ T F Sbjct: 124 DIKARGRFGVVWRAQLGNQEVAVKIFPMQERQSWITEQDIF 164 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 567 LYKAQVRPRVEYCSHLW 517 LY A VRP +EY S +W Sbjct: 820 LYYALVRPLLEYASIIW 836 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 6.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +1 Query: 355 HSPWNIRNKIQREPKSL 405 H PWN +QR K L Sbjct: 445 HEPWNASESVQRAAKCL 461 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 926,875 Number of Sequences: 2352 Number of extensions: 21127 Number of successful extensions: 39 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -