BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B24 (861 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.90 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 25 1.2 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 3.6 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 3.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.3 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 8.4 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 8.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.4 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 8.4 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.0 bits (52), Expect = 0.90 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +3 Query: 390 GTEVPPQTQRFQTIRETGIIDNPNGPPLYGVKWKK 494 G E+ P TQ R N G P+ V W K Sbjct: 309 GAEIEPSTQTIDFGRPATFTCNVRGNPIKTVSWLK 343 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 731 IPRRIPATFREYWXXGVDIRAMSRFGVIGRQS 636 IPRRIP E + G +R + IGR++ Sbjct: 788 IPRRIPMDATEVYLDGNVLRELQNHVFIGRKN 819 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 23.0 bits (47), Expect = 3.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 485 FDSIQRRAVRIVDNPGLTDRLEPLGL 408 +DSI+ R I D +T+ PLGL Sbjct: 167 YDSIEARDSAIFDGDFITENNLPLGL 192 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 23.0 bits (47), Expect = 3.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 46 PPDGEWLPSPMDFSNARG 99 PPD W P + F+NA G Sbjct: 104 PPDKVWKPDIVLFNNADG 121 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -3 Query: 550 PASRGVLLPSLXRGSPNTSFFHLTPYRGGPF 458 P G+ +PS G P+ F + PF Sbjct: 1139 PGPNGIKMPSFMEGMPHLPFTPFNFWNPPPF 1169 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -2 Query: 284 VHPYYLEPLRSSTVRFQRSFSPRTIRLWNELPSTV 180 VH +YL PL + + S S + W + +++ Sbjct: 215 VHYHYLSPLSAGLFQGGISISGTALNCWTQTENSL 249 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -2 Query: 284 VHPYYLEPLRSSTVRFQRSFSPRTIRLWNELPSTV 180 VH +YL PL + + S S + W + +++ Sbjct: 86 VHYHYLSPLSAGLFQGGISISGTALNCWTQTENSL 120 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.4 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 369 HTEQNTEGTEVPPQTQRFQTIRETGIIDNPN 461 H E NT+G + TQR Q ++ ++ P+ Sbjct: 164 HPELNTQGIALADLTQRAQIGQKHKLLIGPS 194 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -2 Query: 284 VHPYYLEPLRSSTVRFQRSFSPRTIRLWNELPSTV 180 VH +YL PL + + S S + W + +++ Sbjct: 215 VHYHYLSPLSAGLFQGGISISGTALNCWTQTENSL 249 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,329 Number of Sequences: 438 Number of extensions: 6316 Number of successful extensions: 20 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -