BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B23 (872 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX255925-1|CAM24146.1| 261|Homo sapiens novel protein (DKFZp761... 33 1.4 BC073748-1|AAH73748.1| 118|Homo sapiens Unknown (protein for IM... 30 9.5 >BX255925-1|CAM24146.1| 261|Homo sapiens novel protein (DKFZp761H1710) protein. Length = 261 Score = 33.1 bits (72), Expect = 1.4 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = +3 Query: 543 PAPAPRQTLRPRRRWPPGT-VGTRXTRSFMLLSASGELHLXPCPRR 677 PAP P TL P+R WP T + + + G H P PRR Sbjct: 52 PAPRPTPTLAPKRAWPSDTEIIVNQACGGDMPALEGAPHTPPLPRR 97 >BC073748-1|AAH73748.1| 118|Homo sapiens Unknown (protein for IMAGE:6301005) protein. Length = 118 Score = 30.3 bits (65), Expect = 9.5 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 504 RERLVKGLSCPRSPAPAPRQTLRPRRRWPPGTVG 605 R R +G P+S APA R W PGT G Sbjct: 10 RTRNARGTKAPQSVAPASSSRKSVSRHWHPGTSG 43 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,809,224 Number of Sequences: 237096 Number of extensions: 1745675 Number of successful extensions: 4023 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3826 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4015 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11104084400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -