BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B23 (872 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 2.8 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 2.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.9 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 8.5 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 8.5 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 8.5 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 8.5 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.8 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 161 VILVLRFVTSVMSCWLFLMKANLYRTTFFFXRSIKVFDYI 42 ++L++ V + W+F +L + F S+ +FD I Sbjct: 66 MLLIMSLVGNCCVIWIFSTSKSLRTPSNMFIVSLAIFDII 105 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 2.8 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 161 VILVLRFVTSVMSCWLFLMKANLYRTTFFFXRSIKVFDYI 42 ++L++ V + W+F +L + F S+ +FD I Sbjct: 66 MLLIMSLVGNCCVIWIFSTSKSLRTPSNMFIVSLAIFDII 105 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 491 ITPFPSLAFREIHNTFAFRIYIVTSI 414 + PFP+ AFR+ ++ A+R S+ Sbjct: 89 LLPFPAAAFRQDVHSAAYRCVASNSV 114 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 491 ITPFPSLAFREIHNTFAFRIYIVTSI 414 + PFP+ AFR+ ++ A+R S+ Sbjct: 89 LLPFPAAAFRQDVHSAAYRCVASNSV 114 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 438 SYLYSNFNSFRLQHA**NNLGSTRYVAVTGCVYIP 334 +Y YSN+N++ + NN +Y + IP Sbjct: 88 NYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIP 122 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 438 SYLYSNFNSFRLQHA**NNLGSTRYVAVTGCVYIP 334 +Y YSN+N++ + NN +Y + IP Sbjct: 88 NYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIP 122 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 438 SYLYSNFNSFRLQHA**NNLGSTRYVAVTGCVYIP 334 +Y YSN+N++ + NN +Y + IP Sbjct: 88 NYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIP 122 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 438 SYLYSNFNSFRLQHA**NNLGSTRYVAVTGCVYIP 334 +Y YSN+N++ + NN +Y + IP Sbjct: 88 NYKYSNYNNYNNNNYNNNNYKKLQYYNINYIEQIP 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,225 Number of Sequences: 438 Number of extensions: 3465 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28280841 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -