BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B21 (803 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0471 - 18121023-18121213,18121954-18122080,18122221-181222... 29 5.7 12_02_0841 + 23579344-23579394,23579522-23579584,23579717-235798... 28 7.6 >11_04_0471 - 18121023-18121213,18121954-18122080,18122221-18122253, 18122969-18123009,18123415-18123484,18123626-18123744, 18123876-18123942,18124735-18124809,18125023-18125050, 18125130-18125179,18125679-18125741,18125829-18125870, 18126000-18126078,18127233-18127368,18128013-18128517, 18129238-18129372 Length = 586 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = +3 Query: 486 DIRYNLWLVILAFQ-RLHDVIDFLVAQQVSQWIDRH 590 +I N WLV + + H+V D + +++ WIDRH Sbjct: 477 NIVQNAWLVYFWRRAKTHNVEDDIAEERLQMWIDRH 512 >12_02_0841 + 23579344-23579394,23579522-23579584,23579717-23579826, 23580220-23580320,23580816-23580877,23580972-23581112, 23581388-23581523,23582257-23582284,23582665-23582728, 23582924-23583044,23583565-23583623,23583716-23583784, 23583875-23584015,23584130-23584194,23584345-23584441, 23584803-23584862,23585409-23585561,23586022-23586088, 23586174-23586284,23586689-23586799,23587370-23587567, 23587679-23587860 Length = 729 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 726 RCAMIYYDLRVVWYDYLMWN 785 +C M Y +WYDY MW+ Sbjct: 252 QCLMYLYHHPDIWYDYAMWH 271 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,564,204 Number of Sequences: 37544 Number of extensions: 296738 Number of successful extensions: 580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 580 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -