BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B18 (843 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual 27 4.4 SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr... 26 5.8 >SPBC13E7.05 |gpi14||pig-M|Schizosaccharomyces pombe|chr 2|||Manual Length = 815 Score = 26.6 bits (56), Expect = 4.4 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +3 Query: 456 IITVTISRLSYCEIHFSREKTGKSAPESLLYK-APVTRTALQLN-SYCCLHSAGFS 617 ++++ IS L YC + F K+ + + L+K P+ L L+ S+ C+ + G S Sbjct: 163 LVSIGISTLYYCFVQFMEVKSALISYDRSLFKFYPIDLFVLLLSQSFICIIAFGVS 218 >SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 26.2 bits (55), Expect = 5.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 404 WFALYNHQNLCSTFLIMAMTVQLFCHPPLSKSR 306 W+++ N +L + L MA TVQ + H P +SR Sbjct: 349 WYSISNDPSLANKRLEMAFTVQEY-HSPNGQSR 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,674,991 Number of Sequences: 5004 Number of extensions: 50173 Number of successful extensions: 114 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 416455520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -