BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B17 (839 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993 31 1.5 05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522,408... 29 6.1 >07_03_0335 - 16903775-16904118,16904203-16904325,16904424-16905993 Length = 678 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 480 SESERPDSLSETLNAFLTENCNYHYSNVSLLLD 578 S SE+P S+ T++A L + N H S+V + +D Sbjct: 545 SRSEKPASIGSTIDAVLLQEGNTHTSDVEMSMD 577 >05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522, 4086671-4087357,4087555-4087813,4088435-4088558, 4089474-4089564 Length = 580 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = +3 Query: 435 SSSGAKRIFNTHFLDSESERPDSLSETLNAFLTENCNY 548 S G +F+ D+E + S T A + +NCNY Sbjct: 449 SDKGTVHVFSLRVKDAEEDAKKGESATAGAQVNDNCNY 486 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,081,960 Number of Sequences: 37544 Number of extensions: 323810 Number of successful extensions: 530 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -