BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B13 (766 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 28 0.36 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 25 3.4 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 25 3.4 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 24 4.5 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 24 4.5 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 24 4.5 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 24 4.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 24 4.5 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 24 4.5 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 24 5.9 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 24 5.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 5.9 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 24 5.9 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 7.8 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 27.9 bits (59), Expect = 0.36 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = -1 Query: 466 CKSCIICVLKSRPDRAXPAAHLHVHGIPSSGSEFAADPTAHQQP 335 CKSC I + R + P L V P PT ++P Sbjct: 346 CKSCSISPVSDRSESVSPVPSLPVRSSPEPSPVLLRSPTPAKKP 389 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA++ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIQHVGSVHAAP 53 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIASSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSTIQHHAAPAIHHVGSVHAAP 53 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA++ G +HAAP Sbjct: 26 GSIATSHSTIQHHARPAIQHVGSIHAAP 53 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.9 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 228 TKIIVFFSYGNIRLSTTRSSQALRDPF*ISIQNAHLKFKYMIKGFL 91 T ++VF + GN+ + + + + +R I+I AHL ++ FL Sbjct: 55 TTLMVFSATGNLTVLSILAQRKVRASSRINIMLAHLAIADLLVTFL 100 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.8 bits (49), Expect = 5.9 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = -2 Query: 228 TKIIVFFSYGNIRLSTTRSSQALRDPF*ISIQNAHLKFKYMIKGFL 91 T ++VF + GN+ + + + + +R I+I AHL ++ FL Sbjct: 55 TTLMVFSATGNLTVLSILAQRKVRASSRINIMLAHLAIADLLVTFL 100 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 5.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 436 SRPDRAXPAAHLHVHGIPSSGSEFAADPTAHQQ 338 SRP + P +H + IP+ A HQQ Sbjct: 355 SRPVASGPTSHYYPSHIPAGSQPVPAVVNPHQQ 387 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.8 bits (49), Expect = 5.9 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSIHAAP 53 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -3 Query: 575 GCCAQQHDVPPRARGPAVRQQGQLHAAP 492 G A H PA+ G +HAAP Sbjct: 26 GSIATSHSSIQHHAAPAIHHVGSVHAAP 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 678,037 Number of Sequences: 2352 Number of extensions: 13782 Number of successful extensions: 33 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -