BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B11 (847 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 2.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 2.9 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 24 6.7 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 24 6.7 Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. 23 8.8 AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-tran... 23 8.8 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.4 bits (53), Expect = 2.2 Identities = 17/49 (34%), Positives = 20/49 (40%) Frame = -1 Query: 337 LSPGRTXXXXXXXXXXXRQTASWSTSGRSTTGCGRRTSGPASTSAGNRP 191 LSP T TAS ++ S G TS PAS S G +P Sbjct: 224 LSPVHTAPAIPVSSCSPLSTASSASCSSSAAGSLCPTSPPASVSNGEQP 272 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 25.0 bits (52), Expect = 2.9 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 Query: 192 GRFPADVLAGPLVLRPQPVVERPEVLQEAVCLHLPLSGQRL 314 G F L+G L + P+P + P + V HLP + +L Sbjct: 839 GPFRVVALSGILAVTPRPHKQAPNMQTTRVIRHLPTNDIQL 879 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 281 DGLLEYFRPLHDW 243 D LL F+P HDW Sbjct: 600 DRLLHCFKPTHDW 612 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 23.8 bits (49), Expect = 6.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 281 DGLLEYFRPLHDW 243 D LL F+P HDW Sbjct: 600 DRLLHCFKPTHDW 612 >Y17717-1|CAA76832.1| 101|Anopheles gambiae cE5 protein protein. Length = 101 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 173 PSQLSELNVKEPASSPATQQSDS 105 P L N E AS+PA SDS Sbjct: 79 PEFLRNSNTDEQASAPAASSSDS 101 >AF513639-1|AAM53611.1| 195|Anopheles gambiae glutathione S-transferase S1-2 protein. Length = 195 Score = 23.4 bits (48), Expect = 8.8 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 395 IYQSVAAGNALANMLKMGSSKPWPDAM 315 ++QSVA LAN + + + W + M Sbjct: 53 VHQSVAMSRYLANQVGLAGADDWENLM 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 652,159 Number of Sequences: 2352 Number of extensions: 12480 Number of successful extensions: 40 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89718867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -