BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B11 (847 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.7 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 22 8.2 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 22 8.2 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.4 bits (48), Expect = 2.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 650 KEDAAGRXQLPLLEAKGSSXQGVEPPV 570 KED +P LE G +G+ PPV Sbjct: 201 KEDHDDHYGVPTLEELGFDTEGLLPPV 227 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 8.2 Identities = 17/69 (24%), Positives = 27/69 (39%) Frame = +3 Query: 426 PGRVLARQLAQRTVELELDYERHVISGVFDVGRHMVLGCGVEVVLSSIDGRLHALXAAPF 605 P + LA + + + VIS + +GC V V SI G A+ A Sbjct: 91 PSNMFIVSLAIFDIIMAFEMPMLVISSFMERMIGWEIGCDVYSVFGSISGMGQAMTNAAI 150 Query: 606 SFQ*WQLXS 632 +F ++ S Sbjct: 151 AFDRYRTIS 159 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.8 bits (44), Expect = 8.2 Identities = 17/69 (24%), Positives = 27/69 (39%) Frame = +3 Query: 426 PGRVLARQLAQRTVELELDYERHVISGVFDVGRHMVLGCGVEVVLSSIDGRLHALXAAPF 605 P + LA + + + VIS + +GC V V SI G A+ A Sbjct: 91 PSNMFIVSLAIFDIIMAFEMPMLVISSFMERMIGWEIGCDVYSVFGSISGMGQAMTNAAI 150 Query: 606 SFQ*WQLXS 632 +F ++ S Sbjct: 151 AFDRYRTIS 159 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,078 Number of Sequences: 438 Number of extensions: 3385 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -