BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B07 (761 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) 174 7e-44 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 34 0.14 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 33 0.25 SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) 33 0.25 SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 33 0.25 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 33 0.25 SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 33 0.25 SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 33 0.25 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) 33 0.25 SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) 33 0.25 SB_58420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 33 0.25 SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) 33 0.25 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 33 0.25 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 33 0.25 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 33 0.25 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 33 0.25 SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) 33 0.25 SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) 33 0.25 SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) 33 0.25 SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 33 0.25 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 33 0.25 SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) 33 0.25 SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_1556| Best HMM Match : Toxin_19 (HMM E-Value=6.8) 31 1.0 SB_23988| Best HMM Match : F5_F8_type_C (HMM E-Value=5e-10) 31 1.4 SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) 30 2.4 SB_8681| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_30396| Best HMM Match : M20_dimer (HMM E-Value=4e-08) 28 7.2 >SB_48345| Best HMM Match : Ribosomal_L22 (HMM E-Value=0) Length = 142 Score = 174 bits (423), Expect = 7e-44 Identities = 83/121 (68%), Positives = 100/121 (82%), Gaps = 2/121 (1%) Frame = -3 Query: 561 GLSLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPFRRFNGGVGRCAQAKQFGT 382 G +LRVH+KNT+E AMAI+ M +R+A RYLK+V KK+ +PFR++NGGVGR AQAK Sbjct: 19 GSNLRVHYKNTHEAAMAIKGMHVRKANRYLKDVCAKKQLVPFRKYNGGVGRKAQAKNLKV 78 Query: 381 --TQGRWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRAHGRI 208 +QGRWPKKSAE LLQLL+NAESNA+ K LDVD LV++HIQVN AP +RRRTYRAHGRI Sbjct: 79 PGSQGRWPKKSAEILLQLLKNAESNAEFKGLDVDSLVVEHIQVNEAPSMRRRTYRAHGRI 138 Query: 207 N 205 N Sbjct: 139 N 139 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 33.9 bits (74), Expect = 0.14 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +1 Query: 637 RPNGHSCFLCEIVIRPAA*AKVRRLDXSRCXLW 735 R +GHSCFLCEIVIR + R +C W Sbjct: 264 RNHGHSCFLCEIVIRSQFPHNI-RAGSIKCKAW 295 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 116 RNHGHSCFLCEIVIR 130 >SB_42207| Best HMM Match : Ank (HMM E-Value=6.3) Length = 71 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 46 RNHGHSCFLCEIVIR 60 >SB_41480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 80 RNHGHSCFLCEIVIR 94 >SB_38636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 51 RNHGHSCFLCEIVIR 65 >SB_36790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 32 RNHGHSCFLCEIVIR 46 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 215 RNHGHSCFLCEIVIR 229 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 118 RNHGHSCFLCEIVIR 132 >SB_33616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 62 RNHGHSCFLCEIVIR 76 >SB_31742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 47 RNHGHSCFLCEIVIR 61 >SB_30562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 71 RNHGHSCFLCEIVIR 85 >SB_26344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 81 RNHGHSCFLCEIVIR 95 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 193 RNHGHSCFLCEIVIR 207 >SB_11590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 76 RNHGHSCFLCEIVIR 90 >SB_9170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 48 RNHGHSCFLCEIVIR 62 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 112 RNHGHSCFLCEIVIR 126 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 134 RNHGHSCFLCEIVIR 148 >SB_1641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 63 RNHGHSCFLCEIVIR 77 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 130 RNHGHSCFLCEIVIR 144 >SB_59544| Best HMM Match : Secretin_N_2 (HMM E-Value=7.9) Length = 158 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 133 RNHGHSCFLCEIVIR 147 >SB_59174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 35 RNHGHSCFLCEIVIR 49 >SB_59049| Best HMM Match : NUMOD1 (HMM E-Value=6) Length = 77 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 52 RNHGHSCFLCEIVIR 66 >SB_58420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 679 Score = 33.1 bits (72), Expect = 0.25 Identities = 26/117 (22%), Positives = 50/117 (42%), Gaps = 2/117 (1%) Frame = -3 Query: 600 SRLVPVRDSSSTVGLSLRVHFKNTYETAMAIRKMPLRRAVRYL-KNVIEKKECIPFRR-F 427 +RLVP ++S+ ++ + VH T + K Y+ N+ + +C F F Sbjct: 431 ARLVPRKESTDSLRMKAHVHIARIQLTQRFVLKKKYYMYCTYICLNLTKFSQCRLFGAIF 490 Query: 426 NGGVGRCAQAKQFGTTQGRWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVN 256 + +G+ Q+ T+ R P + E RN ++ D + V+ + Q+N Sbjct: 491 DNSLGKTRYRSQYKHTRRRHPCSTCEQYRSRNRNCARKHPYRSADAKK-VLKNFQIN 546 >SB_56976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 77 RNHGHSCFLCEIVIR 91 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 175 RNHGHSCFLCEIVIR 189 >SB_55903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 64 RNHGHSCFLCEIVIR 78 >SB_55293| Best HMM Match : Hemopexin (HMM E-Value=6.7) Length = 64 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 39 RNHGHSCFLCEIVIR 53 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 223 RNHGHSCFLCEIVIR 237 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 170 RNHGHSCFLCEIVIR 184 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 166 RNHGHSCFLCEIVIR 180 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 142 RNHGHSCFLCEIVIR 156 >SB_50168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 78 RNHGHSCFLCEIVIR 92 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 199 RNHGHSCFLCEIVIR 213 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 155 RNHGHSCFLCEIVIR 169 >SB_41348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 16 RNHGHSCFLCEIVIR 30 >SB_40846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 63 RNHGHSCFLCEIVIR 77 >SB_38671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 42 RNHGHSCFLCEIVIR 56 >SB_38587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 129 RNHGHSCFLCEIVIR 143 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 139 RNHGHSCFLCEIVIR 153 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 105 RNHGHSCFLCEIVIR 119 >SB_36182| Best HMM Match : Fic (HMM E-Value=2.3e-19) Length = 181 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 156 RNHGHSCFLCEIVIR 170 >SB_35762| Best HMM Match : Beta-lactamase (HMM E-Value=7.2e-05) Length = 166 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 141 RNHGHSCFLCEIVIR 155 >SB_34299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 63 RNHGHSCFLCEIVIR 77 >SB_34022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 104 RNHGHSCFLCEIVIR 118 >SB_33552| Best HMM Match : MIF (HMM E-Value=9.7) Length = 148 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 123 RNHGHSCFLCEIVIR 137 >SB_33362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 121 RNHGHSCFLCEIVIR 135 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 127 RNHGHSCFLCEIVIR 141 >SB_24533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 36 RNHGHSCFLCEIVIR 50 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 115 RNHGHSCFLCEIVIR 129 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 132 RNHGHSCFLCEIVIR 146 >SB_18725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 80 RNHGHSCFLCEIVIR 94 >SB_17826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 74 RNHGHSCFLCEIVIR 88 >SB_16932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 41 RNHGHSCFLCEIVIR 55 >SB_16803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 47 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 22 RNHGHSCFLCEIVIR 36 >SB_14402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 31 RNHGHSCFLCEIVIR 45 >SB_14049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 105 RNHGHSCFLCEIVIR 119 >SB_13755| Best HMM Match : Cyto_ox_2 (HMM E-Value=5.5e-09) Length = 194 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 169 RNHGHSCFLCEIVIR 183 >SB_13220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 57 RNHGHSCFLCEIVIR 71 >SB_10480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 35 RNHGHSCFLCEIVIR 49 >SB_10241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 130 RNHGHSCFLCEIVIR 144 >SB_9002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 47 RNHGHSCFLCEIVIR 61 >SB_6812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 160 RNHGHSCFLCEIVIR 174 >SB_5020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 662 RNHGHSCFLCEIVIR 676 >SB_3366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.1 bits (72), Expect = 0.25 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 637 RPNGHSCFLCEIVIR 681 R +GHSCFLCEIVIR Sbjct: 86 RNHGHSCFLCEIVIR 100 >SB_1556| Best HMM Match : Toxin_19 (HMM E-Value=6.8) Length = 99 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 516 LRSHMCS*SEHGAIGQQCSRNPGPVPACFFVQTC 617 LR H C+ + G +C+ P PAC+ + +C Sbjct: 20 LRLHCCASNGPAVAGCRCANRPNTTPACWVMSSC 53 >SB_23988| Best HMM Match : F5_F8_type_C (HMM E-Value=5e-10) Length = 304 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/61 (29%), Positives = 32/61 (52%) Frame = -3 Query: 612 FVQKSRLVPVRDSSSTVGLSLRVHFKNTYETAMAIRKMPLRRAVRYLKNVIEKKECIPFR 433 ++ + ++ VR +V SLRV +Y+ + K+ +RR R + + +ECI FR Sbjct: 201 YLDGNGVIKVRHHMCSVEYSLRVDHLQSYQDGNGVIKVRIRREKR-TEPLQPNQECIVFR 259 Query: 432 R 430 R Sbjct: 260 R 260 >SB_42875| Best HMM Match : RGM_C (HMM E-Value=2.6e-27) Length = 471 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = -3 Query: 399 AKQFGTTQGRWPKKSAEFLLQLLRNAESNADNKTLDVDRLVIDHIQVNRAPCLRRRTYRA 220 AKQ +G WP FL+ + N D + + IQ N+ C++++ Y+A Sbjct: 202 AKQTCVVEGAWPLVENHFLIVQVTNVPL-VDGSSATATNKITVIIQENKDSCVQQKIYKA 260 >SB_8681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 28.3 bits (60), Expect = 7.2 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 584 SGIPRALLAYRSVFTLRTHMRPQWQ 510 + + A++AY ++ TLR M+P W+ Sbjct: 200 NALDAAIMAYNNISTLRQQMKPAWR 224 >SB_30396| Best HMM Match : M20_dimer (HMM E-Value=4e-08) Length = 489 Score = 28.3 bits (60), Expect = 7.2 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 587 RSGIPRALLAYRSVFTLRTHMRPQWQ 510 R+ + +LAY S+ LR M+P W+ Sbjct: 286 RNALDAVVLAYNSISALRQQMKPTWR 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,747,536 Number of Sequences: 59808 Number of extensions: 483264 Number of successful extensions: 1355 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 1262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1354 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2082369341 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -