BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B07 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 25 0.77 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 23 4.1 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 25.0 bits (52), Expect = 0.77 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 Query: 442 NTLFLFNHVFEVTNSTTERHLSDCHCGLICVLKV 543 N FL + +F+ LSD GL C + V Sbjct: 312 NARFLMDSMFDFAERVNSLRLSDAELGLFCSVVV 345 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.6 bits (46), Expect = 4.1 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 614 LFYSVT*IGLMVIAVSCVKLLSVPRPRLKS 703 L+Y+VT I ++ + V ++ PR+KS Sbjct: 140 LYYTVTTILAAIVGIVMVLIIHPGDPRIKS 169 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,117 Number of Sequences: 438 Number of extensions: 4019 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -