BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B05 (838 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 26 1.6 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 8.7 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.8 bits (54), Expect = 1.6 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +1 Query: 559 MSLCYWISFRRNLCPSFFF-RVYGLV 633 M++CYW+ + L +FF +Y LV Sbjct: 617 MAICYWMKQKYQLIAAFFISAIYSLV 642 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.4 bits (48), Expect = 8.7 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 581 RLDAISARLFFFEFMAWYLGPLGQLPVFMGGCW 679 R+D S R F+ WY+ + L CW Sbjct: 378 RMDTTSGRSGLFKGGGWYMLGVQSLSALCLACW 410 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,807 Number of Sequences: 2352 Number of extensions: 14348 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -