BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_B01 (766 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 24 1.5 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 4.7 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 22 6.2 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 6.2 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 6.2 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 582 LRPRRRWPPGYCWYSETRSFMLLSASVNSISSMPSPVYQCKKALR 716 L+P+R++ YC T+S+ LL P C KA R Sbjct: 74 LKPKRQFICKYCNRQFTKSYNLLIHERTHTDERPYSCDICGKAFR 118 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 4.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 Query: 519 RERLVKGLSCPRSPAPA 569 R+RLVK C RS AP+ Sbjct: 137 RDRLVKEGICDRSTAPS 153 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.8 bits (44), Expect = 6.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 527 TLSSLY*ITPFPSLAFREIHNTFAFRIYIVTSI 429 T+ L+ + REI+ FAF++ + TS+ Sbjct: 132 TIKKLFNLHKILVKVVREINGIFAFQVLMCTSM 164 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.8 bits (44), Expect = 6.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 111 FISYNFFFSRSIKVFDY 61 F+SYN + +++ F+Y Sbjct: 192 FVSYNIYVCQTVSNFEY 208 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 21.8 bits (44), Expect = 6.2 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = -2 Query: 111 FISYNFFFSRSIKVFDY 61 F+SYN + +++ F+Y Sbjct: 118 FVSYNIYVCQTVSNFEY 134 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,366 Number of Sequences: 336 Number of extensions: 2795 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -