BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A21 (800 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 29 0.22 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 29 0.22 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 26 1.6 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 4.8 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 24 4.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 24 4.8 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 6.3 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 8.3 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 28.7 bits (61), Expect = 0.22 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 684 SDRTQASALRSXVPR*QALQGRSREALSGPR*SASTKTLRSHQENPLHRR 535 S R+++ +L V R ++ RSR S R + T+T RS PL R Sbjct: 416 SSRSRSRSLSRSVSRSRSRGSRSRSRTSQSRSRSKTRTSRSRSRTPLPAR 465 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 28.7 bits (61), Expect = 0.22 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 494 PYPVYKEVQVPLVKEVPYPVKYHVPIY 414 P PV+++V VP+ VP V ++V +Y Sbjct: 167 PVPVFQKVGVPVPHPVPIAVPHYVKVY 193 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 692 PYPVTVHKPVPYEVKSP 642 P P TV KP P EV+ P Sbjct: 223 PVPYTVEKPYPIEVEKP 239 Score = 25.8 bits (54), Expect = 1.6 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -1 Query: 503 IDKPYPVYKEVQVPLVKEVPYPV----KYHVPI 417 I+KP P E P+ E P+PV K+ VP+ Sbjct: 220 IEKPVPYTVEKPYPIEVEKPFPVEVLKKFEVPV 252 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -1 Query: 503 IDKPYPV--YKEVQVPLVKEVPYPV 435 ++KP+PV K+ +VP+ K P PV Sbjct: 236 VEKPFPVEVLKKFEVPVPKPYPVPV 260 Score = 25.4 bits (53), Expect = 2.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 488 PVYKEVQVPLVKEVPYPVKYHVPIYFKK 405 P+YK + + K VPY V+ PI +K Sbjct: 211 PIYKVIPKVIEKPVPYTVEKPYPIEVEK 238 Score = 25.4 bits (53), Expect = 2.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 692 PYPVTVHKPVPYEV 651 PYP+ V KP P EV Sbjct: 231 PYPIEVEKPFPVEV 244 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 686 PVTVHKPVPYEVKSP 642 P + KPVPY V+ P Sbjct: 217 PKVIEKPVPYTVEKP 231 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 25.8 bits (54), Expect = 1.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -2 Query: 583 QYQNLTKSSRKSLTPSKRKCLMKSKCLLTSPT 488 Q NL++ + + T + CL + + LLT+PT Sbjct: 7 QEVNLSRRACRPTTTNNDDCLQEQRTLLTTPT 38 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/54 (22%), Positives = 23/54 (42%) Frame = +2 Query: 77 IRINNKHVKANKVITDYNYTTSRLGNELPRSVYQRKRRLK*CSQQPINTQNTTT 238 I N H K++ T N++ + P S+ R+R + + ++ T T Sbjct: 507 ITTTNTHPKSSASSTSLNHSNPISSSAPPSSIVSRRRFFNTSASSSVTSEGTIT 560 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/54 (22%), Positives = 23/54 (42%) Frame = +2 Query: 77 IRINNKHVKANKVITDYNYTTSRLGNELPRSVYQRKRRLK*CSQQPINTQNTTT 238 I N H K++ T N++ + P S+ R+R + + ++ T T Sbjct: 508 ITTTNTHPKSSASSTSLNHSNPISSSAPPSSIVSRRRFFNTSASSSVTSEGTIT 561 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 24.2 bits (50), Expect = 4.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -2 Query: 556 RKSLTPSKRKCLMKSKC 506 ++++TP R +MKSKC Sbjct: 58 KENMTPEDRSLVMKSKC 74 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = -3 Query: 312 VNKKKKCDFFSIFSVYY 262 V+K + DFFS+FS+++ Sbjct: 389 VSKGTQHDFFSVFSIFF 405 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 8.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 567 VRFWYWHFNGDRIGLLYFD 623 ++F W FNGD++ L ++ Sbjct: 167 MKFGSWTFNGDQVSLALYN 185 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,219 Number of Sequences: 2352 Number of extensions: 9925 Number of successful extensions: 51 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -