BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A14 (796 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 27 0.51 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 27 0.88 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 24 4.7 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 8.2 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 27.5 bits (58), Expect = 0.51 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -2 Query: 243 PEPPPRALNGIETDPTLVSNLLKESLAKPVPISVPTEKKSPIEVKR 106 P+P P +N + + ++ + + KPVP +V EK PIEV++ Sbjct: 195 PQPYPLQVNVEQPIKIPIYKVIPKVIEKPVPYTV--EKPYPIEVEK 238 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 26.6 bits (56), Expect = 0.88 Identities = 23/83 (27%), Positives = 34/83 (40%), Gaps = 10/83 (12%) Frame = -2 Query: 390 EQPKP----RQRQHSNSEPELVPVMKKIDETPGYENIMKENQRII------KNKVSERKP 241 +QP P R +Q L PV + ++ P N N+ I K+K + KP Sbjct: 54 QQPGPSGLQRLQQQQQQPSRLTPVREAVENIPSPRNGPNINEGSINKRKKKKSKKKQNKP 113 Query: 240 EPPPRALNGIETDPTLVSNLLKE 172 P AL + ++ LLKE Sbjct: 114 RKRPEALLISDCTSEELAKLLKE 136 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 24.2 bits (50), Expect = 4.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 417 SPFSSPPSIEQPKPRQRQHSNSEPELVPVMK 325 +P SS +QPK ++++ S +PE V + K Sbjct: 147 TPKSSGGQSKQPKKKKKKRSLPKPEAVVIEK 177 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.4 bits (48), Expect = 8.2 Identities = 10/50 (20%), Positives = 23/50 (46%) Frame = -2 Query: 318 DETPGYENIMKENQRIIKNKVSERKPEPPPRALNGIETDPTLVSNLLKES 169 DE P ++ + + + + K+ E + A+N + D L +K++ Sbjct: 162 DENPKFDKNIDDKEYVDPTKIKEELAKKKMEAMNEVAADADLDDAKMKKT 211 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,845 Number of Sequences: 2352 Number of extensions: 9043 Number of successful extensions: 23 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83576403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -