BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A10 (813 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q234C7 Cluster: Protein kinase domain containing protei... 36 1.2 UniRef50_O47572 Cluster: NADH-ubiquinone oxidoreductase chain 4;... 33 8.6 >UniRef50_Q234C7 Cluster: Protein kinase domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Protein kinase domain containing protein - Tetrahymena thermophila SB210 Length = 573 Score = 35.9 bits (79), Expect = 1.2 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 4/84 (4%) Frame = +3 Query: 348 NILYSINFYYHSRDRAKI*NYNYTACL*HNIQKLGQLIDSFSIVKFFF*NIDVNNIR--- 518 NI+ +FY D I Y CL IQKL + +FSI+KF F NI + ++ Sbjct: 138 NIIRIFDFYQDEEDFYIITEYIEGGCLFDEIQKLSKRYFNFSIIKFDF-NISLKKLKQQF 196 Query: 519 -K*HLPEIFLSVTLIFTLYHNISV 587 + H +I + + H+I++ Sbjct: 197 NEYHACQIMQQILMAVNYAHSINI 220 >UniRef50_O47572 Cluster: NADH-ubiquinone oxidoreductase chain 4; n=3; Onchocercidae|Rep: NADH-ubiquinone oxidoreductase chain 4 - Onchocerca volvulus Length = 410 Score = 33.1 bits (72), Expect = 8.6 Identities = 18/56 (32%), Positives = 31/56 (55%) Frame = -3 Query: 736 FIVKMIVFLSDIDQIFCDAVQMCEHSVRVDCGALLFDAVFLYHSFVLVSETEMLWY 569 F +M++F S I +FC + + V+ DC +L + + FVL+SE M++Y Sbjct: 218 FGFEMLIFFSLISMVFCSFICV----VQSDCKSLAAYSSVCHMGFVLLSEISMVYY 269 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,804,025 Number of Sequences: 1657284 Number of extensions: 11381675 Number of successful extensions: 21922 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21914 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 70377768045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -