BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A10 (813 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26) 29 3.4 SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26) Length = 298 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 607 SFVLVSETEMLWYNVKINV-TLRNISGKCYFLILLT 503 SFV+ SE+E ++NVK N TL + G +FL T Sbjct: 146 SFVMFSESESAYFNVKRNENTLAIVDGLVHFLTCYT 181 >SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2988 Score = 28.3 bits (60), Expect = 7.8 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 2/42 (4%) Frame = +2 Query: 656 HAVFAHLHSVTKYLIN-VT*EYDHLYNKFXDPQSAL-TXERL 775 HA FA+LH+VT Y + V E+ Y F +P++ + T ER+ Sbjct: 378 HATFAYLHAVTCYNTSFVKGEHMDYYWNFANPRNIVSTKERI 419 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,247,057 Number of Sequences: 59808 Number of extensions: 372961 Number of successful extensions: 725 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -