BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= FWDP01_T7_A10 (813 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 4.4 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 5.9 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 194 HGWI*VLLYATLKSSKYQAQYELS*FSTGGPPIQY 298 + W+ V + + ++ + QY L F+TG P + Y Sbjct: 162 NNWLSVFWGSAWQWNEERKQYYLHQFATGQPDLNY 196 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 5.9 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +1 Query: 325 KTLFSACXXXXXXXXXXXXVGTGRKSEITTTQHACNITFKN*VN 456 + L AC V TG SEIT Q A + +K+ N Sbjct: 197 ENLVQACFQQAQTTYVTKEVATGTASEITQIQEA-TLVYKDGTN 239 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,457 Number of Sequences: 438 Number of extensions: 3388 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -